Protein Description: transcription elongation factor A (SII)-like 7
Gene Name: TCEAL7
Alternative Gene Name: MGC23947, WEX5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079428: 66%, ENSRNOG00000037645: 75%
Entrez Gene ID: 56849
Uniprot ID: Q9BRU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TCEAL7
Alternative Gene Name: MGC23947, WEX5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079428: 66%, ENSRNOG00000037645: 75%
Entrez Gene ID: 56849
Uniprot ID: Q9BRU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLE |
| Documents & Links for Anti TCEAL7 pAb (ATL-HPA065080) | |
| Datasheet | Anti TCEAL7 pAb (ATL-HPA065080) Datasheet (External Link) |
| Vendor Page | Anti TCEAL7 pAb (ATL-HPA065080) at Atlas |
| Documents & Links for Anti TCEAL7 pAb (ATL-HPA065080) | |
| Datasheet | Anti TCEAL7 pAb (ATL-HPA065080) Datasheet (External Link) |
| Vendor Page | Anti TCEAL7 pAb (ATL-HPA065080) |