Anti TCEAL7 pAb (ATL-HPA065080)

Atlas Antibodies

Catalog No: ATL-HPA065080-25

• 

Product Description

Protein Description: transcription elongation factor A (SII)-like 7
Gene Name: TCEAL7
Alternative Gene Name: MGC23947, WEX5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079428: 66%, ENSRNOG00000037645: 75%
Entrez Gene ID: 56849
Uniprot ID: Q9BRU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLE
• Gene Sequence: KPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLE
• Gene ID - Mouse: ENSMUSG00000079428
• Gene ID - Rat: ENSRNOG00000037645
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.