Protein Description: transcription elongation factor A like 1
Gene Name: TCEAL1
Alternative Gene Name: p21, pp21, SIIR, WEX9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049536: 61%, ENSRNOG00000002387: 57%
Entrez Gene ID: 9338
Uniprot ID: Q15170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TCEAL1
Alternative Gene Name: p21, pp21, SIIR, WEX9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049536: 61%, ENSRNOG00000002387: 57%
Entrez Gene ID: 9338
Uniprot ID: Q15170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE |
Documents & Links for Anti TCEAL1 pAb (ATL-HPA076762) | |
Datasheet | Anti TCEAL1 pAb (ATL-HPA076762) Datasheet (External Link) |
Vendor Page | Anti TCEAL1 pAb (ATL-HPA076762) at Atlas |
Documents & Links for Anti TCEAL1 pAb (ATL-HPA076762) | |
Datasheet | Anti TCEAL1 pAb (ATL-HPA076762) Datasheet (External Link) |
Vendor Page | Anti TCEAL1 pAb (ATL-HPA076762) |