Protein Description: transforming growth factor beta regulator 4
Gene Name: TBRG4
Alternative Gene Name: Cpr2, FASTKD4, H_TD2522F11.8, KIAA0948
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000384: 65%, ENSRNOG00000052477: 68%
Entrez Gene ID: 9238
Uniprot ID: Q969Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBRG4
Alternative Gene Name: Cpr2, FASTKD4, H_TD2522F11.8, KIAA0948
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000384: 65%, ENSRNOG00000052477: 68%
Entrez Gene ID: 9238
Uniprot ID: Q969Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKP |
Documents & Links for Anti TBRG4 pAb (ATL-HPA020582 w/enhanced validation) | |
Datasheet | Anti TBRG4 pAb (ATL-HPA020582 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TBRG4 pAb (ATL-HPA020582 w/enhanced validation) at Atlas |
Documents & Links for Anti TBRG4 pAb (ATL-HPA020582 w/enhanced validation) | |
Datasheet | Anti TBRG4 pAb (ATL-HPA020582 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TBRG4 pAb (ATL-HPA020582 w/enhanced validation) |