Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation)

Catalog No:
ATL-HPA078657-25
$447.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Description

Product Description

Protein Description: T-box, brain 1
Gene Name: TBR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035033: 99%, ENSRNOG00000005049: 100%
Entrez Gene ID: 10716
Uniprot ID: Q16650
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYG
Gene Sequence LLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYG
Gene ID - Mouse ENSMUSG00000035033
Gene ID - Rat ENSRNOG00000005049
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation)
Datasheet Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation)
Datasheet Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation)

Product Description

Protein Description: T-box, brain 1
Gene Name: TBR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035033: 99%, ENSRNOG00000005049: 100%
Entrez Gene ID: 10716
Uniprot ID: Q16650
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYG
Gene Sequence LLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYG
Gene ID - Mouse ENSMUSG00000035033
Gene ID - Rat ENSRNOG00000005049
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation)
Datasheet Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation)
Datasheet Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TBR1 pAb (ATL-HPA078657 w/enhanced validation)