Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation)

Catalog No:
ATL-HPA078644-25
$401.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: T-box, brain 1
Gene Name: TBR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035033: 100%, ENSRNOG00000005049: 100%
Entrez Gene ID: 10716
Uniprot ID: Q16650
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD

Documents & Links for Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation)
Datasheet Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation) at Atlas

Documents & Links for Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation)
Datasheet Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation)