Protein Description: T-box, brain 1
Gene Name: TBR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035033: 100%, ENSRNOG00000005049: 100%
Entrez Gene ID: 10716
Uniprot ID: Q16650
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035033: 100%, ENSRNOG00000005049: 100%
Entrez Gene ID: 10716
Uniprot ID: Q16650
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD |
Gene ID - Mouse | ENSMUSG00000035033 |
Gene ID - Rat | ENSMUSG00000035033 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation) | |
Datasheet | Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation) at Atlas |
Documents & Links for Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation) | |
Datasheet | Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TBR1 pAb (ATL-HPA078644 w/enhanced validation) |