Protein Description: TBP-like 1
Gene Name: TBPL1
Alternative Gene Name: STUD, TLF, TLP, TRF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071359: 100%, ENSRNOG00000011114: 100%
Entrez Gene ID: 9519
Uniprot ID: P62380
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBPL1
Alternative Gene Name: STUD, TLF, TLP, TRF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071359: 100%, ENSRNOG00000011114: 100%
Entrez Gene ID: 9519
Uniprot ID: P62380
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEI |
| Documents & Links for Anti TBPL1 pAb (ATL-HPA071810) | |
| Datasheet | Anti TBPL1 pAb (ATL-HPA071810) Datasheet (External Link) |
| Vendor Page | Anti TBPL1 pAb (ATL-HPA071810) at Atlas |
| Documents & Links for Anti TBPL1 pAb (ATL-HPA071810) | |
| Datasheet | Anti TBPL1 pAb (ATL-HPA071810) Datasheet (External Link) |
| Vendor Page | Anti TBPL1 pAb (ATL-HPA071810) |