Description
Product Description
Protein Description: TBP-like 1
Gene Name: TBPL1
Alternative Gene Name: STUD, TLF, TLP, TRF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071359: 100%, ENSRNOG00000011114: 100%
Entrez Gene ID: 9519
Uniprot ID: P62380
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBPL1
Alternative Gene Name: STUD, TLF, TLP, TRF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071359: 100%, ENSRNOG00000011114: 100%
Entrez Gene ID: 9519
Uniprot ID: P62380
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEI |
Gene Sequence | CNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEI |
Gene ID - Mouse | ENSMUSG00000071359 |
Gene ID - Rat | ENSRNOG00000011114 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TBPL1 pAb (ATL-HPA071810) | |
Datasheet | Anti TBPL1 pAb (ATL-HPA071810) Datasheet (External Link) |
Vendor Page | Anti TBPL1 pAb (ATL-HPA071810) at Atlas Antibodies |
Documents & Links for Anti TBPL1 pAb (ATL-HPA071810) | |
Datasheet | Anti TBPL1 pAb (ATL-HPA071810) Datasheet (External Link) |
Vendor Page | Anti TBPL1 pAb (ATL-HPA071810) |