Protein Description: TBK1 binding protein 1
Gene Name: TBKBP1
Alternative Gene Name: KIAA0775, ProSAPiP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038517: 96%, ENSRNOG00000009370: 94%
Entrez Gene ID: 9755
Uniprot ID: A7MCY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBKBP1
Alternative Gene Name: KIAA0775, ProSAPiP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038517: 96%, ENSRNOG00000009370: 94%
Entrez Gene ID: 9755
Uniprot ID: A7MCY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSG |
Documents & Links for Anti TBKBP1 pAb (ATL-HPA064856) | |
Datasheet | Anti TBKBP1 pAb (ATL-HPA064856) Datasheet (External Link) |
Vendor Page | Anti TBKBP1 pAb (ATL-HPA064856) at Atlas |
Documents & Links for Anti TBKBP1 pAb (ATL-HPA064856) | |
Datasheet | Anti TBKBP1 pAb (ATL-HPA064856) Datasheet (External Link) |
Vendor Page | Anti TBKBP1 pAb (ATL-HPA064856) |