Protein Description: TBC1 domain family, member 24
Gene Name: TBC1D24
Alternative Gene Name: DFNA65, DFNB86, KIAA1171, TLDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036473: 95%, ENSRNOG00000052204: 95%
Entrez Gene ID: 57465
Uniprot ID: Q9ULP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBC1D24
Alternative Gene Name: DFNA65, DFNB86, KIAA1171, TLDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036473: 95%, ENSRNOG00000052204: 95%
Entrez Gene ID: 57465
Uniprot ID: Q9ULP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDLNRGRTSHCDTFNNQPLCSENFLIAAVEAWGFQDPD |
| Documents & Links for Anti TBC1D24 pAb (ATL-HPA068080) | |
| Datasheet | Anti TBC1D24 pAb (ATL-HPA068080) Datasheet (External Link) |
| Vendor Page | Anti TBC1D24 pAb (ATL-HPA068080) at Atlas |
| Documents & Links for Anti TBC1D24 pAb (ATL-HPA068080) | |
| Datasheet | Anti TBC1D24 pAb (ATL-HPA068080) Datasheet (External Link) |
| Vendor Page | Anti TBC1D24 pAb (ATL-HPA068080) |