Description
Product Description
Protein Description: TBC1 domain family member 2
Gene Name: TBC1D2
Alternative Gene Name: Armus, PARIS1, TBC1D2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039813: 83%, ENSRNOG00000023348: 85%
Entrez Gene ID: 55357
Uniprot ID: Q9BYX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBC1D2
Alternative Gene Name: Armus, PARIS1, TBC1D2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039813: 83%, ENSRNOG00000023348: 85%
Entrez Gene ID: 55357
Uniprot ID: Q9BYX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEALGDEASECSELLRQLVQEALQWEAGEASSDSIELSPISKYDEYGFLTVPDYEVEDLKLL |
Gene Sequence | VAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEALGDEASECSELLRQLVQEALQWEAGEASSDSIELSPISKYDEYGFLTVPDYEVEDLKLL |
Gene ID - Mouse | ENSMUSG00000039813 |
Gene ID - Rat | ENSRNOG00000023348 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TBC1D2 pAb (ATL-HPA076521) | |
Datasheet | Anti TBC1D2 pAb (ATL-HPA076521) Datasheet (External Link) |
Vendor Page | Anti TBC1D2 pAb (ATL-HPA076521) at Atlas Antibodies |
Documents & Links for Anti TBC1D2 pAb (ATL-HPA076521) | |
Datasheet | Anti TBC1D2 pAb (ATL-HPA076521) Datasheet (External Link) |
Vendor Page | Anti TBC1D2 pAb (ATL-HPA076521) |