Description
Product Description
Protein Description: TBC1 domain family, member 17
Gene Name: TBC1D17
Alternative Gene Name: FLJ12168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038520: 80%, ENSRNOG00000020191: 82%
Entrez Gene ID: 79735
Uniprot ID: Q9HA65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBC1D17
Alternative Gene Name: FLJ12168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038520: 80%, ENSRNOG00000020191: 82%
Entrez Gene ID: 79735
Uniprot ID: Q9HA65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQILFSKKDSSGGDSCASEEEPTFDPGYEPDWAVISTVRPQLCHSEPTRGAEPSC |
Gene Sequence | GVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQILFSKKDSSGGDSCASEEEPTFDPGYEPDWAVISTVRPQLCHSEPTRGAEPSC |
Gene ID - Mouse | ENSMUSG00000038520 |
Gene ID - Rat | ENSRNOG00000020191 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TBC1D17 pAb (ATL-HPA068119) | |
Datasheet | Anti TBC1D17 pAb (ATL-HPA068119) Datasheet (External Link) |
Vendor Page | Anti TBC1D17 pAb (ATL-HPA068119) at Atlas Antibodies |
Documents & Links for Anti TBC1D17 pAb (ATL-HPA068119) | |
Datasheet | Anti TBC1D17 pAb (ATL-HPA068119) Datasheet (External Link) |
Vendor Page | Anti TBC1D17 pAb (ATL-HPA068119) |