Protein Description: TBC1 domain family, member 14
Gene Name: TBC1D14
Alternative Gene Name: KIAA1322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029192: 89%, ENSRNOG00000006400: 90%
Entrez Gene ID: 57533
Uniprot ID: Q9P2M4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBC1D14
Alternative Gene Name: KIAA1322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029192: 89%, ENSRNOG00000006400: 90%
Entrez Gene ID: 57533
Uniprot ID: Q9P2M4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | APPAPSSTEREQSVRKSSTFPRTGYDSVKLYSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNEDILDLVVTSSSSAIVTLENDDDP |
Documents & Links for Anti TBC1D14 pAb (ATL-HPA067398) | |
Datasheet | Anti TBC1D14 pAb (ATL-HPA067398) Datasheet (External Link) |
Vendor Page | Anti TBC1D14 pAb (ATL-HPA067398) at Atlas |
Documents & Links for Anti TBC1D14 pAb (ATL-HPA067398) | |
Datasheet | Anti TBC1D14 pAb (ATL-HPA067398) Datasheet (External Link) |
Vendor Page | Anti TBC1D14 pAb (ATL-HPA067398) |