Protein Description: TBC1 domain family, member 10C
Gene Name: TBC1D10C
Alternative Gene Name: Carabin, EPI64C, FLJ00332
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097708: 76%, ENSRNOG00000021510: 84%
Entrez Gene ID: 374403
Uniprot ID: Q8IV04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBC1D10C
Alternative Gene Name: Carabin, EPI64C, FLJ00332
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097708: 76%, ENSRNOG00000021510: 84%
Entrez Gene ID: 374403
Uniprot ID: Q8IV04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEM |
Documents & Links for Anti TBC1D10C pAb (ATL-HPA069743 w/enhanced validation) | |
Datasheet | Anti TBC1D10C pAb (ATL-HPA069743 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TBC1D10C pAb (ATL-HPA069743 w/enhanced validation) at Atlas |
Documents & Links for Anti TBC1D10C pAb (ATL-HPA069743 w/enhanced validation) | |
Datasheet | Anti TBC1D10C pAb (ATL-HPA069743 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TBC1D10C pAb (ATL-HPA069743 w/enhanced validation) |