Protein Description: TAR (HIV-1) RNA binding protein 2
Gene Name: TARBP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023051: 96%, ENSRNOG00000042355: 95%
Entrez Gene ID: 6895
Uniprot ID: Q15633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TARBP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023051: 96%, ENSRNOG00000042355: 95%
Entrez Gene ID: 6895
Uniprot ID: Q15633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSG |
Documents & Links for Anti TARBP2 pAb (ATL-HPA061454) | |
Datasheet | Anti TARBP2 pAb (ATL-HPA061454) Datasheet (External Link) |
Vendor Page | Anti TARBP2 pAb (ATL-HPA061454) at Atlas |
Documents & Links for Anti TARBP2 pAb (ATL-HPA061454) | |
Datasheet | Anti TARBP2 pAb (ATL-HPA061454) Datasheet (External Link) |
Vendor Page | Anti TARBP2 pAb (ATL-HPA061454) |