Protein Description: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Gene Name: TAP1
Alternative Gene Name: ABCB2, D6S114E, PSF1, RING4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037321: 70%, ENSRNOG00000000457: 70%
Entrez Gene ID: 6890
Uniprot ID: Q03518
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TAP1
Alternative Gene Name: ABCB2, D6S114E, PSF1, RING4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037321: 70%, ENSRNOG00000000457: 70%
Entrez Gene ID: 6890
Uniprot ID: Q03518
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK |
Documents & Links for Anti TAP1 pAb (ATL-HPA072354) | |
Datasheet | Anti TAP1 pAb (ATL-HPA072354) Datasheet (External Link) |
Vendor Page | Anti TAP1 pAb (ATL-HPA072354) at Atlas |
Documents & Links for Anti TAP1 pAb (ATL-HPA072354) | |
Datasheet | Anti TAP1 pAb (ATL-HPA072354) Datasheet (External Link) |
Vendor Page | Anti TAP1 pAb (ATL-HPA072354) |