Anti TAP1 pAb (ATL-HPA072354)

Atlas Antibodies

Catalog No: ATL-HPA072354-25

• 

Product Description

Protein Description: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Gene Name: TAP1
Alternative Gene Name: ABCB2, D6S114E, PSF1, RING4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037321: 70%, ENSRNOG00000000457: 70%
Entrez Gene ID: 6890
Uniprot ID: Q03518
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK
• Gene Sequence: DDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK
• Gene ID - Mouse: ENSMUSG00000037321
• Gene ID - Rat: ENSRNOG00000000457
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.