Protein Description: TAL bHLH transcription factor 1, erythroid differentiation factor
Gene Name: TAL1
Alternative Gene Name: bHLHa17, SCL, TCL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028717: 92%, ENSRNOG00000025051: 92%
Entrez Gene ID: 6886
Uniprot ID: P17542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TAL1
Alternative Gene Name: bHLHa17, SCL, TCL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028717: 92%, ENSRNOG00000025051: 92%
Entrez Gene ID: 6886
Uniprot ID: P17542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG |
Documents & Links for Anti TAL1 pAb (ATL-HPA073983) | |
Datasheet | Anti TAL1 pAb (ATL-HPA073983) Datasheet (External Link) |
Vendor Page | Anti TAL1 pAb (ATL-HPA073983) at Atlas |
Documents & Links for Anti TAL1 pAb (ATL-HPA073983) | |
Datasheet | Anti TAL1 pAb (ATL-HPA073983) Datasheet (External Link) |
Vendor Page | Anti TAL1 pAb (ATL-HPA073983) |