Anti TAF9 pAb (ATL-HPA072658)

Atlas Antibodies

Catalog No: ATL-HPA072658-25

• 

Product Description

Protein Description: TATA-box binding protein associated factor 9
Gene Name: TAF9
Alternative Gene Name: AD-004, CGI-137, MGC1603, MGC3647, MGC5067, TAF2G, TAFII31, TAFII32, TAFIID32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052293: 92%, ENSRNOG00000051258: 92%
Entrez Gene ID: 6880
Uniprot ID: Q16594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG
• Gene Sequence: ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG
• Gene ID - Mouse: ENSMUSG00000052293
• Gene ID - Rat: ENSRNOG00000051258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.