Protein Description: TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Gene Name: TAF6L
Alternative Gene Name: PAF65A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003680: 96%, ENSRNOG00000019419: 96%
Entrez Gene ID: 10629
Uniprot ID: Q9Y6J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TAF6L
Alternative Gene Name: PAF65A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003680: 96%, ENSRNOG00000019419: 96%
Entrez Gene ID: 10629
Uniprot ID: Q9Y6J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP |
Documents & Links for Anti TAF6L pAb (ATL-HPA067239) | |
Datasheet | Anti TAF6L pAb (ATL-HPA067239) Datasheet (External Link) |
Vendor Page | Anti TAF6L pAb (ATL-HPA067239) at Atlas |
Documents & Links for Anti TAF6L pAb (ATL-HPA067239) | |
Datasheet | Anti TAF6L pAb (ATL-HPA067239) Datasheet (External Link) |
Vendor Page | Anti TAF6L pAb (ATL-HPA067239) |