Anti TAF6L pAb (ATL-HPA067239)

Catalog No:
ATL-HPA067239-25
$447.00

Description

Product Description

Protein Description: TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Gene Name: TAF6L
Alternative Gene Name: PAF65A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003680: 96%, ENSRNOG00000019419: 96%
Entrez Gene ID: 10629
Uniprot ID: Q9Y6J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP
Gene Sequence LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP
Gene ID - Mouse ENSMUSG00000003680
Gene ID - Rat ENSRNOG00000019419
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TAF6L pAb (ATL-HPA067239)
Datasheet Anti TAF6L pAb (ATL-HPA067239) Datasheet (External Link)
Vendor Page Anti TAF6L pAb (ATL-HPA067239) at Atlas Antibodies

Documents & Links for Anti TAF6L pAb (ATL-HPA067239)
Datasheet Anti TAF6L pAb (ATL-HPA067239) Datasheet (External Link)
Vendor Page Anti TAF6L pAb (ATL-HPA067239)

Product Description

Protein Description: TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Gene Name: TAF6L
Alternative Gene Name: PAF65A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003680: 96%, ENSRNOG00000019419: 96%
Entrez Gene ID: 10629
Uniprot ID: Q9Y6J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP
Gene Sequence LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP
Gene ID - Mouse ENSMUSG00000003680
Gene ID - Rat ENSRNOG00000019419
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TAF6L pAb (ATL-HPA067239)
Datasheet Anti TAF6L pAb (ATL-HPA067239) Datasheet (External Link)
Vendor Page Anti TAF6L pAb (ATL-HPA067239) at Atlas Antibodies

Documents & Links for Anti TAF6L pAb (ATL-HPA067239)
Datasheet Anti TAF6L pAb (ATL-HPA067239) Datasheet (External Link)
Vendor Page Anti TAF6L pAb (ATL-HPA067239)