Description
Product Description
Protein Description: TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
Gene Name: TAF15
Alternative Gene Name: hTAFII68, Npl3, RBP56, TAF2N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020680: 84%, ENSRNOG00000058393: 84%
Entrez Gene ID: 8148
Uniprot ID: Q92804
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TAF15
Alternative Gene Name: hTAFII68, Npl3, RBP56, TAF2N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020680: 84%, ENSRNOG00000058393: 84%
Entrez Gene ID: 8148
Uniprot ID: Q92804
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY |
Gene Sequence | SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY |
Gene ID - Mouse | ENSMUSG00000020680 |
Gene ID - Rat | ENSRNOG00000058393 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TAF15 pAb (ATL-HPA063647 w/enhanced validation) | |
Datasheet | Anti TAF15 pAb (ATL-HPA063647 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TAF15 pAb (ATL-HPA063647 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TAF15 pAb (ATL-HPA063647 w/enhanced validation) | |
Datasheet | Anti TAF15 pAb (ATL-HPA063647 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TAF15 pAb (ATL-HPA063647 w/enhanced validation) |