Protein Description: tachykinin receptor 3
Gene Name: TACR3
Alternative Gene Name: NK3R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028172: 60%, ENSRNOG00000009372: 55%
Entrez Gene ID: 6870
Uniprot ID: P29371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TACR3
Alternative Gene Name: NK3R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028172: 60%, ENSRNOG00000009372: 55%
Entrez Gene ID: 6870
Uniprot ID: P29371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWS |
Gene Sequence | MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWS |
Gene ID - Mouse | ENSMUSG00000028172 |
Gene ID - Rat | ENSRNOG00000009372 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TACR3 pAb (ATL-HPA009418) | |
Datasheet | Anti TACR3 pAb (ATL-HPA009418) Datasheet (External Link) |
Vendor Page | Anti TACR3 pAb (ATL-HPA009418) at Atlas Antibodies |
Documents & Links for Anti TACR3 pAb (ATL-HPA009418) | |
Datasheet | Anti TACR3 pAb (ATL-HPA009418) Datasheet (External Link) |
Vendor Page | Anti TACR3 pAb (ATL-HPA009418) |