Anti TACR3 pAb (ATL-HPA009418)

Catalog No:
ATL-HPA009418-25
$447.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: tachykinin receptor 3
Gene Name: TACR3
Alternative Gene Name: NK3R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028172: 60%, ENSRNOG00000009372: 55%
Entrez Gene ID: 6870
Uniprot ID: P29371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWS
Gene Sequence MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWS
Gene ID - Mouse ENSMUSG00000028172
Gene ID - Rat ENSRNOG00000009372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TACR3 pAb (ATL-HPA009418)
Datasheet Anti TACR3 pAb (ATL-HPA009418) Datasheet (External Link)
Vendor Page Anti TACR3 pAb (ATL-HPA009418) at Atlas Antibodies

Documents & Links for Anti TACR3 pAb (ATL-HPA009418)
Datasheet Anti TACR3 pAb (ATL-HPA009418) Datasheet (External Link)
Vendor Page Anti TACR3 pAb (ATL-HPA009418)