Anti TACC1 pAb (ATL-HPA056841)

Atlas Antibodies

Catalog No: ATL-HPA056841-25

• 
• 

Product Description

Protein Description: transforming acidic coiled-coil containing protein 1
Gene Name: TACC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000065954: 53%, ENSRNOG00000016423: 48%
Entrez Gene ID: 6867
Uniprot ID: O75410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSSDTNDSGV
• Gene Sequence: RRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSSDTNDSGV
• Gene ID - Mouse: ENSMUSG00000065954
• Gene ID - Rat: ENSRNOG00000016423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.