Protein Description: tachykinin, precursor 1
Gene Name: TAC1
Alternative Gene Name: NKNA, NPK, TAC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061762: 96%, ENSRNOG00000007374: 97%
Entrez Gene ID: 6863
Uniprot ID: P20366
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TAC1
Alternative Gene Name: NKNA, NPK, TAC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061762: 96%, ENSRNOG00000007374: 97%
Entrez Gene ID: 6863
Uniprot ID: P20366
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR |
| Documents & Links for Anti TAC1 pAb (ATL-HPA014429) | |
| Datasheet | Anti TAC1 pAb (ATL-HPA014429) Datasheet (External Link) |
| Vendor Page | Anti TAC1 pAb (ATL-HPA014429) at Atlas |
| Documents & Links for Anti TAC1 pAb (ATL-HPA014429) | |
| Datasheet | Anti TAC1 pAb (ATL-HPA014429) Datasheet (External Link) |
| Vendor Page | Anti TAC1 pAb (ATL-HPA014429) |