Anti TAC1 pAb (ATL-HPA014429)

Catalog No:
ATL-HPA014429-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: tachykinin, precursor 1
Gene Name: TAC1
Alternative Gene Name: NKNA, NPK, TAC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061762: 96%, ENSRNOG00000007374: 97%
Entrez Gene ID: 6863
Uniprot ID: P20366
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR
Gene Sequence WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR
Gene ID - Mouse ENSMUSG00000061762
Gene ID - Rat ENSRNOG00000007374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TAC1 pAb (ATL-HPA014429)
Datasheet Anti TAC1 pAb (ATL-HPA014429) Datasheet (External Link)
Vendor Page Anti TAC1 pAb (ATL-HPA014429) at Atlas Antibodies

Documents & Links for Anti TAC1 pAb (ATL-HPA014429)
Datasheet Anti TAC1 pAb (ATL-HPA014429) Datasheet (External Link)
Vendor Page Anti TAC1 pAb (ATL-HPA014429)