Protein Description: tachykinin, precursor 1
Gene Name: TAC1
Alternative Gene Name: NKNA, NPK, TAC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061762: 96%, ENSRNOG00000007374: 97%
Entrez Gene ID: 6863
Uniprot ID: P20366
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TAC1
Alternative Gene Name: NKNA, NPK, TAC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061762: 96%, ENSRNOG00000007374: 97%
Entrez Gene ID: 6863
Uniprot ID: P20366
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR |
Gene Sequence | WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR |
Gene ID - Mouse | ENSMUSG00000061762 |
Gene ID - Rat | ENSRNOG00000007374 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TAC1 pAb (ATL-HPA014429) | |
Datasheet | Anti TAC1 pAb (ATL-HPA014429) Datasheet (External Link) |
Vendor Page | Anti TAC1 pAb (ATL-HPA014429) at Atlas |
Documents & Links for Anti TAC1 pAb (ATL-HPA014429) | |
Datasheet | Anti TAC1 pAb (ATL-HPA014429) Datasheet (External Link) |
Vendor Page | Anti TAC1 pAb (ATL-HPA014429) |