Description
Product Description
Protein Description: TGF-beta activated kinase 1/MAP3K7 binding protein 2
Gene Name: TAB2
Alternative Gene Name: KIAA0733, MAP3K7IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015755: 93%, ENSRNOG00000016054: 90%
Entrez Gene ID: 23118
Uniprot ID: Q9NYJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TAB2
Alternative Gene Name: KIAA0733, MAP3K7IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015755: 93%, ENSRNOG00000016054: 90%
Entrez Gene ID: 23118
Uniprot ID: Q9NYJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS |
Gene Sequence | HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS |
Gene ID - Mouse | ENSMUSG00000015755 |
Gene ID - Rat | ENSRNOG00000016054 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TAB2 pAb (ATL-HPA070137) | |
Datasheet | Anti TAB2 pAb (ATL-HPA070137) Datasheet (External Link) |
Vendor Page | Anti TAB2 pAb (ATL-HPA070137) at Atlas Antibodies |
Documents & Links for Anti TAB2 pAb (ATL-HPA070137) | |
Datasheet | Anti TAB2 pAb (ATL-HPA070137) Datasheet (External Link) |
Vendor Page | Anti TAB2 pAb (ATL-HPA070137) |