Anti TAB2 pAb (ATL-HPA070137)

Catalog No:
ATL-HPA070137-25
$395.00

Description

Product Description

Protein Description: TGF-beta activated kinase 1/MAP3K7 binding protein 2
Gene Name: TAB2
Alternative Gene Name: KIAA0733, MAP3K7IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015755: 93%, ENSRNOG00000016054: 90%
Entrez Gene ID: 23118
Uniprot ID: Q9NYJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS
Gene Sequence HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS
Gene ID - Mouse ENSMUSG00000015755
Gene ID - Rat ENSRNOG00000016054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TAB2 pAb (ATL-HPA070137)
Datasheet Anti TAB2 pAb (ATL-HPA070137) Datasheet (External Link)
Vendor Page Anti TAB2 pAb (ATL-HPA070137) at Atlas Antibodies

Documents & Links for Anti TAB2 pAb (ATL-HPA070137)
Datasheet Anti TAB2 pAb (ATL-HPA070137) Datasheet (External Link)
Vendor Page Anti TAB2 pAb (ATL-HPA070137)

Product Description

Protein Description: TGF-beta activated kinase 1/MAP3K7 binding protein 2
Gene Name: TAB2
Alternative Gene Name: KIAA0733, MAP3K7IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015755: 93%, ENSRNOG00000016054: 90%
Entrez Gene ID: 23118
Uniprot ID: Q9NYJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS
Gene Sequence HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS
Gene ID - Mouse ENSMUSG00000015755
Gene ID - Rat ENSRNOG00000016054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TAB2 pAb (ATL-HPA070137)
Datasheet Anti TAB2 pAb (ATL-HPA070137) Datasheet (External Link)
Vendor Page Anti TAB2 pAb (ATL-HPA070137) at Atlas Antibodies

Documents & Links for Anti TAB2 pAb (ATL-HPA070137)
Datasheet Anti TAB2 pAb (ATL-HPA070137) Datasheet (External Link)
Vendor Page Anti TAB2 pAb (ATL-HPA070137)