Protein Description: synaptotagmin like 4
Gene Name: SYTL4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031255: 91%, ENSRNOG00000003526: 91%
Entrez Gene ID: 94121
Uniprot ID: Q96C24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYTL4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031255: 91%, ENSRNOG00000003526: 91%
Entrez Gene ID: 94121
Uniprot ID: Q96C24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIK |
| Documents & Links for Anti SYTL4 pAb (ATL-HPA075138) | |
| Datasheet | Anti SYTL4 pAb (ATL-HPA075138) Datasheet (External Link) |
| Vendor Page | Anti SYTL4 pAb (ATL-HPA075138) at Atlas |
| Documents & Links for Anti SYTL4 pAb (ATL-HPA075138) | |
| Datasheet | Anti SYTL4 pAb (ATL-HPA075138) Datasheet (External Link) |
| Vendor Page | Anti SYTL4 pAb (ATL-HPA075138) |