Description
Product Description
Protein Description: synaptotagmin like 4
Gene Name: SYTL4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031255: 91%, ENSRNOG00000003526: 91%
Entrez Gene ID: 94121
Uniprot ID: Q96C24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYTL4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031255: 91%, ENSRNOG00000003526: 91%
Entrez Gene ID: 94121
Uniprot ID: Q96C24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIK |
Gene Sequence | NTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIK |
Gene ID - Mouse | ENSMUSG00000031255 |
Gene ID - Rat | ENSRNOG00000003526 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SYTL4 pAb (ATL-HPA075138) | |
Datasheet | Anti SYTL4 pAb (ATL-HPA075138) Datasheet (External Link) |
Vendor Page | Anti SYTL4 pAb (ATL-HPA075138) at Atlas Antibodies |
Documents & Links for Anti SYTL4 pAb (ATL-HPA075138) | |
Datasheet | Anti SYTL4 pAb (ATL-HPA075138) Datasheet (External Link) |
Vendor Page | Anti SYTL4 pAb (ATL-HPA075138) |