Protein Description: synaptotagmin-like 3
Gene Name: SYTL3
Alternative Gene Name: exophilin-6, SLP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041831: 78%, ENSRNOG00000018321: 78%
Entrez Gene ID: 94120
Uniprot ID: Q4VX76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYTL3
Alternative Gene Name: exophilin-6, SLP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041831: 78%, ENSRNOG00000018321: 78%
Entrez Gene ID: 94120
Uniprot ID: Q4VX76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TWDFEDSTTQSFRWHPLRAKAEKYEDSVPQSNGELTVRAKLVLPSRPRKLQEAQEGTDQPSLHGQLCLVVLGAKNLPVRPDGTLNSFVKGCL |
| Gene ID - Mouse | ENSMUSG00000041831 |
| Gene ID - Rat | ENSMUSG00000041831 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SYTL3 pAb (ATL-HPA030586) | |
| Datasheet | Anti SYTL3 pAb (ATL-HPA030586) Datasheet (External Link) |
| Vendor Page | Anti SYTL3 pAb (ATL-HPA030586) at Atlas |
| Documents & Links for Anti SYTL3 pAb (ATL-HPA030586) | |
| Datasheet | Anti SYTL3 pAb (ATL-HPA030586) Datasheet (External Link) |
| Vendor Page | Anti SYTL3 pAb (ATL-HPA030586) |