Protein Description: synaptotagmin-like 3
Gene Name: SYTL3
Alternative Gene Name: exophilin-6, SLP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041831: 75%, ENSRNOG00000018321: 75%
Entrez Gene ID: 94120
Uniprot ID: Q4VX76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYTL3
Alternative Gene Name: exophilin-6, SLP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041831: 75%, ENSRNOG00000018321: 75%
Entrez Gene ID: 94120
Uniprot ID: Q4VX76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ALKELEREAILQVLYRDQAVQNTEEERTRKLKTHLQHLRWKGAKNTDWEHKEKCCARCQQVLGFLLHRGAVCRGCSHRVCAQCR |
Gene ID - Mouse | ENSMUSG00000041831 |
Gene ID - Rat | ENSMUSG00000041831 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SYTL3 pAb (ATL-HPA030584) | |
Datasheet | Anti SYTL3 pAb (ATL-HPA030584) Datasheet (External Link) |
Vendor Page | Anti SYTL3 pAb (ATL-HPA030584) at Atlas |
Documents & Links for Anti SYTL3 pAb (ATL-HPA030584) | |
Datasheet | Anti SYTL3 pAb (ATL-HPA030584) Datasheet (External Link) |
Vendor Page | Anti SYTL3 pAb (ATL-HPA030584) |