Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation)

Catalog No:
ATL-HPA078390-25
$447.00
Protein Description: synaptotagmin 5
Gene Name: SYT5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004961: 84%, ENSRNOG00000018217: 86%
Entrez Gene ID: 6861
Uniprot ID: O00445
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence CRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPS
Gene ID - Mouse ENSMUSG00000004961
Gene ID - Rat ENSMUSG00000004961
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation)
Datasheet Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation) at Atlas

Documents & Links for Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation)
Datasheet Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation)