Protein Description: synaptotagmin 16
Gene Name: SYT16
Alternative Gene Name: CHR14SYT, Strep14, SYT14L, yt14r
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044912: 46%, ENSRNOG00000056012: 54%
Entrez Gene ID: 83851
Uniprot ID: Q17RD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYT16
Alternative Gene Name: CHR14SYT, Strep14, SYT14L, yt14r
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044912: 46%, ENSRNOG00000056012: 54%
Entrez Gene ID: 83851
Uniprot ID: Q17RD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VTSEKGKQTGLEQKPKFSRSLLTHGEDGTEVSACEDLDGASQRRYSENLSYGEDDHIPAHSQSPCERGDAKHHGTSHQESSVVQSLRRQSTEGSLEME |
| Documents & Links for Anti SYT16 pAb (ATL-HPA076871) | |
| Datasheet | Anti SYT16 pAb (ATL-HPA076871) Datasheet (External Link) |
| Vendor Page | Anti SYT16 pAb (ATL-HPA076871) at Atlas |
| Documents & Links for Anti SYT16 pAb (ATL-HPA076871) | |
| Datasheet | Anti SYT16 pAb (ATL-HPA076871) Datasheet (External Link) |
| Vendor Page | Anti SYT16 pAb (ATL-HPA076871) |