Protein Description: synaptotagmin XV
Gene Name: SYT15
Alternative Gene Name: CHR10SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041479: 82%, ENSRNOG00000051688: 85%
Entrez Gene ID: 83849
Uniprot ID: Q9BQS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYT15
Alternative Gene Name: CHR10SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041479: 82%, ENSRNOG00000051688: 85%
Entrez Gene ID: 83849
Uniprot ID: Q9BQS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPLKNETLVGDCRRVIWRDLEAESL |
| Documents & Links for Anti SYT15 pAb (ATL-HPA064559) | |
| Datasheet | Anti SYT15 pAb (ATL-HPA064559) Datasheet (External Link) |
| Vendor Page | Anti SYT15 pAb (ATL-HPA064559) at Atlas |
| Documents & Links for Anti SYT15 pAb (ATL-HPA064559) | |
| Datasheet | Anti SYT15 pAb (ATL-HPA064559) Datasheet (External Link) |
| Vendor Page | Anti SYT15 pAb (ATL-HPA064559) |