Protein Description: synaptotagmin I
Gene Name: SYT1
Alternative Gene Name: P65, SVP65, SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035864: 85%, ENSRNOG00000006426: 87%
Entrez Gene ID: 6857
Uniprot ID: P21579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYT1
Alternative Gene Name: P65, SVP65, SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035864: 85%, ENSRNOG00000006426: 87%
Entrez Gene ID: 6857
Uniprot ID: P21579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELH |
Documents & Links for Anti SYT1 pAb (ATL-HPA064788 w/enhanced validation) | |
Datasheet | Anti SYT1 pAb (ATL-HPA064788 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SYT1 pAb (ATL-HPA064788 w/enhanced validation) at Atlas |
Documents & Links for Anti SYT1 pAb (ATL-HPA064788 w/enhanced validation) | |
Datasheet | Anti SYT1 pAb (ATL-HPA064788 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SYT1 pAb (ATL-HPA064788 w/enhanced validation) |