Anti SYT1 pAb (ATL-HPA064788 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA064788-25

• 
• 

Product Description

Protein Description: synaptotagmin I
Gene Name: SYT1
Alternative Gene Name: P65, SVP65, SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035864: 85%, ENSRNOG00000006426: 87%
Entrez Gene ID: 6857
Uniprot ID: P21579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELH
• Gene Sequence: MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELH
• Gene ID - Mouse: ENSMUSG00000035864
• Gene ID - Rat: ENSRNOG00000006426
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.