Protein Description: synaptophysin
Gene Name: SYP
Alternative Gene Name: MRX96
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031144: 83%, ENSRNOG00000019780: 37%
Entrez Gene ID: 6855
Uniprot ID: P08247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYP
Alternative Gene Name: MRX96
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031144: 83%, ENSRNOG00000019780: 37%
Entrez Gene ID: 6855
Uniprot ID: P08247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL |
Gene Sequence | DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL |
Gene ID - Mouse | ENSMUSG00000031144 |
Gene ID - Rat | ENSRNOG00000019780 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SYP pAb (ATL-HPA002858 w/enhanced validation) | |
Datasheet | Anti SYP pAb (ATL-HPA002858 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SYP pAb (ATL-HPA002858 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SYP pAb (ATL-HPA002858 w/enhanced validation) | |
Datasheet | Anti SYP pAb (ATL-HPA002858 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SYP pAb (ATL-HPA002858 w/enhanced validation) |