Protein Description: synaptophysin
Gene Name: SYP
Alternative Gene Name: MRX96
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031144: 83%, ENSRNOG00000019780: 37%
Entrez Gene ID: 6855
Uniprot ID: P08247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYP
Alternative Gene Name: MRX96
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031144: 83%, ENSRNOG00000019780: 37%
Entrez Gene ID: 6855
Uniprot ID: P08247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL |
| Documents & Links for Anti SYP pAb (ATL-HPA002858 w/enhanced validation) | |
| Datasheet | Anti SYP pAb (ATL-HPA002858 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SYP pAb (ATL-HPA002858 w/enhanced validation) at Atlas |
| Documents & Links for Anti SYP pAb (ATL-HPA002858 w/enhanced validation) | |
| Datasheet | Anti SYP pAb (ATL-HPA002858 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SYP pAb (ATL-HPA002858 w/enhanced validation) |