Description
Product Description
Protein Description: synaptoporin
Gene Name: SYNPR
Alternative Gene Name: MGC26651, SPO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056296: 97%, ENSRNOG00000008203: 97%
Entrez Gene ID: 132204
Uniprot ID: Q8TBG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYNPR
Alternative Gene Name: MGC26651, SPO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056296: 97%, ENSRNOG00000008203: 97%
Entrez Gene ID: 132204
Uniprot ID: Q8TBG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSL |
Gene Sequence | DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSL |
Gene ID - Mouse | ENSMUSG00000056296 |
Gene ID - Rat | ENSRNOG00000008203 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SYNPR pAb (ATL-HPA061671 w/enhanced validation) | |
Datasheet | Anti SYNPR pAb (ATL-HPA061671 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SYNPR pAb (ATL-HPA061671 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SYNPR pAb (ATL-HPA061671 w/enhanced validation) | |
Datasheet | Anti SYNPR pAb (ATL-HPA061671 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SYNPR pAb (ATL-HPA061671 w/enhanced validation) |