Anti SYNPR pAb (ATL-HPA061671 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061671-25

• 

Product Description

Protein Description: synaptoporin
Gene Name: SYNPR
Alternative Gene Name: MGC26651, SPO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056296: 97%, ENSRNOG00000008203: 97%
Entrez Gene ID: 132204
Uniprot ID: Q8TBG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSL
• Gene Sequence: DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSL
• Gene ID - Mouse: ENSMUSG00000056296
• Gene ID - Rat: ENSRNOG00000008203
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.