Protein Description: synaptopodin
Gene Name: SYNPO
Alternative Gene Name: KIAA1029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043079: 75%, ENSRNOG00000019181: 77%
Entrez Gene ID: 11346
Uniprot ID: Q8N3V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYNPO
Alternative Gene Name: KIAA1029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043079: 75%, ENSRNOG00000019181: 77%
Entrez Gene ID: 11346
Uniprot ID: Q8N3V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LTTPPSSNSRGVQLFNRRRQRVNEFTLESHGQRGQKPSQESLRVLPSSLPGHAPGLSLSSTSLPEPGPPRHPSPQSPDRGVPGHSMEGYSEEASLLRHLEK |
| Documents & Links for Anti SYNPO pAb (ATL-HPA071347) | |
| Datasheet | Anti SYNPO pAb (ATL-HPA071347) Datasheet (External Link) |
| Vendor Page | Anti SYNPO pAb (ATL-HPA071347) at Atlas |
| Documents & Links for Anti SYNPO pAb (ATL-HPA071347) | |
| Datasheet | Anti SYNPO pAb (ATL-HPA071347) Datasheet (External Link) |
| Vendor Page | Anti SYNPO pAb (ATL-HPA071347) |