Anti SYNE3 pAb (ATL-HPA077140)

Catalog No:
ATL-HPA077140-25
$303.00

Description

Product Description

Protein Description: spectrin repeat containing, nuclear envelope family member 3
Gene Name: SYNE3
Alternative Gene Name: C14orf49, FLJ25605, Nesp3, Nesprin-3, NET53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054150: 84%, ENSRNOG00000005287: 85%
Entrez Gene ID: 161176
Uniprot ID: Q6ZMZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVDLVLRMAEALLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLLARDEFYRWFQKMMVTLEPHIELQLGLKEKQWQ
Gene Sequence RVDLVLRMAEALLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLLARDEFYRWFQKMMVTLEPHIELQLGLKEKQWQ
Gene ID - Mouse ENSMUSG00000054150
Gene ID - Rat ENSRNOG00000005287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SYNE3 pAb (ATL-HPA077140)
Datasheet Anti SYNE3 pAb (ATL-HPA077140) Datasheet (External Link)
Vendor Page Anti SYNE3 pAb (ATL-HPA077140) at Atlas Antibodies

Documents & Links for Anti SYNE3 pAb (ATL-HPA077140)
Datasheet Anti SYNE3 pAb (ATL-HPA077140) Datasheet (External Link)
Vendor Page Anti SYNE3 pAb (ATL-HPA077140)

Product Description

Protein Description: spectrin repeat containing, nuclear envelope family member 3
Gene Name: SYNE3
Alternative Gene Name: C14orf49, FLJ25605, Nesp3, Nesprin-3, NET53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054150: 84%, ENSRNOG00000005287: 85%
Entrez Gene ID: 161176
Uniprot ID: Q6ZMZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVDLVLRMAEALLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLLARDEFYRWFQKMMVTLEPHIELQLGLKEKQWQ
Gene Sequence RVDLVLRMAEALLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLLARDEFYRWFQKMMVTLEPHIELQLGLKEKQWQ
Gene ID - Mouse ENSMUSG00000054150
Gene ID - Rat ENSRNOG00000005287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SYNE3 pAb (ATL-HPA077140)
Datasheet Anti SYNE3 pAb (ATL-HPA077140) Datasheet (External Link)
Vendor Page Anti SYNE3 pAb (ATL-HPA077140) at Atlas Antibodies

Documents & Links for Anti SYNE3 pAb (ATL-HPA077140)
Datasheet Anti SYNE3 pAb (ATL-HPA077140) Datasheet (External Link)
Vendor Page Anti SYNE3 pAb (ATL-HPA077140)