Description
Product Description
Protein Description: spectrin repeat containing, nuclear envelope family member 3
Gene Name: SYNE3
Alternative Gene Name: C14orf49, FLJ25605, Nesp3, Nesprin-3, NET53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054150: 84%, ENSRNOG00000005287: 85%
Entrez Gene ID: 161176
Uniprot ID: Q6ZMZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYNE3
Alternative Gene Name: C14orf49, FLJ25605, Nesp3, Nesprin-3, NET53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054150: 84%, ENSRNOG00000005287: 85%
Entrez Gene ID: 161176
Uniprot ID: Q6ZMZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVDLVLRMAEALLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLLARDEFYRWFQKMMVTLEPHIELQLGLKEKQWQ |
Gene Sequence | RVDLVLRMAEALLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLLARDEFYRWFQKMMVTLEPHIELQLGLKEKQWQ |
Gene ID - Mouse | ENSMUSG00000054150 |
Gene ID - Rat | ENSRNOG00000005287 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SYNE3 pAb (ATL-HPA077140) | |
Datasheet | Anti SYNE3 pAb (ATL-HPA077140) Datasheet (External Link) |
Vendor Page | Anti SYNE3 pAb (ATL-HPA077140) at Atlas Antibodies |
Documents & Links for Anti SYNE3 pAb (ATL-HPA077140) | |
Datasheet | Anti SYNE3 pAb (ATL-HPA077140) Datasheet (External Link) |
Vendor Page | Anti SYNE3 pAb (ATL-HPA077140) |