Description
Product Description
Protein Description: SYF2 pre-mRNA-splicing factor
Gene Name: SYF2
Alternative Gene Name: CBPIN, DKFZp564O2082, fSAP29, NTC31, p29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028821: 100%, ENSRNOG00000060597: 100%
Entrez Gene ID: 25949
Uniprot ID: O95926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYF2
Alternative Gene Name: CBPIN, DKFZp564O2082, fSAP29, NTC31, p29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028821: 100%, ENSRNOG00000060597: 100%
Entrez Gene ID: 25949
Uniprot ID: O95926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV |
| Gene Sequence | KRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV |
| Gene ID - Mouse | ENSMUSG00000028821 |
| Gene ID - Rat | ENSRNOG00000060597 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti SYF2 pAb (ATL-HPA070710) | |
| Datasheet | Anti SYF2 pAb (ATL-HPA070710) Datasheet (External Link) |
| Vendor Page | Anti SYF2 pAb (ATL-HPA070710) at Atlas Antibodies |
| Documents & Links for Anti SYF2 pAb (ATL-HPA070710) | |
| Datasheet | Anti SYF2 pAb (ATL-HPA070710) Datasheet (External Link) |
| Vendor Page | Anti SYF2 pAb (ATL-HPA070710) |