Anti SYCE2 pAb (ATL-HPA062919)

Catalog No:
ATL-HPA062919-25
$447.00

Description

Product Description

Protein Description: synaptonemal complex central element protein 2
Gene Name: SYCE2
Alternative Gene Name: CESC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003824: 44%, ENSRNOG00000003279: 44%
Entrez Gene ID: 256126
Uniprot ID: Q6PIF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQP
Gene Sequence MAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQP
Gene ID - Mouse ENSMUSG00000003824
Gene ID - Rat ENSRNOG00000003279
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SYCE2 pAb (ATL-HPA062919)
Datasheet Anti SYCE2 pAb (ATL-HPA062919) Datasheet (External Link)
Vendor Page Anti SYCE2 pAb (ATL-HPA062919) at Atlas Antibodies

Documents & Links for Anti SYCE2 pAb (ATL-HPA062919)
Datasheet Anti SYCE2 pAb (ATL-HPA062919) Datasheet (External Link)
Vendor Page Anti SYCE2 pAb (ATL-HPA062919)

Product Description

Protein Description: synaptonemal complex central element protein 2
Gene Name: SYCE2
Alternative Gene Name: CESC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003824: 44%, ENSRNOG00000003279: 44%
Entrez Gene ID: 256126
Uniprot ID: Q6PIF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQP
Gene Sequence MAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQP
Gene ID - Mouse ENSMUSG00000003824
Gene ID - Rat ENSRNOG00000003279
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SYCE2 pAb (ATL-HPA062919)
Datasheet Anti SYCE2 pAb (ATL-HPA062919) Datasheet (External Link)
Vendor Page Anti SYCE2 pAb (ATL-HPA062919) at Atlas Antibodies

Documents & Links for Anti SYCE2 pAb (ATL-HPA062919)
Datasheet Anti SYCE2 pAb (ATL-HPA062919) Datasheet (External Link)
Vendor Page Anti SYCE2 pAb (ATL-HPA062919)