Protein Description: synaptonemal complex central element protein 2
Gene Name: SYCE2
Alternative Gene Name: CESC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003824: 44%, ENSRNOG00000003279: 44%
Entrez Gene ID: 256126
Uniprot ID: Q6PIF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYCE2
Alternative Gene Name: CESC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003824: 44%, ENSRNOG00000003279: 44%
Entrez Gene ID: 256126
Uniprot ID: Q6PIF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQP |
| Documents & Links for Anti SYCE2 pAb (ATL-HPA062919) | |
| Datasheet | Anti SYCE2 pAb (ATL-HPA062919) Datasheet (External Link) |
| Vendor Page | Anti SYCE2 pAb (ATL-HPA062919) at Atlas |
| Documents & Links for Anti SYCE2 pAb (ATL-HPA062919) | |
| Datasheet | Anti SYCE2 pAb (ATL-HPA062919) Datasheet (External Link) |
| Vendor Page | Anti SYCE2 pAb (ATL-HPA062919) |