Protein Description: synaptic vesicle glycoprotein 2C
Gene Name: SV2C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051111: 96%, ENSRNOG00000018094: 96%
Entrez Gene ID: 22987
Uniprot ID: Q496J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SV2C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051111: 96%, ENSRNOG00000018094: 96%
Entrez Gene ID: 22987
Uniprot ID: Q496J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYE |
| Gene Sequence | GEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYE |
| Gene ID - Mouse | ENSMUSG00000051111 |
| Gene ID - Rat | ENSRNOG00000018094 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SV2C pAb (ATL-HPA040770) | |
| Datasheet | Anti SV2C pAb (ATL-HPA040770) Datasheet (External Link) |
| Vendor Page | Anti SV2C pAb (ATL-HPA040770) at Atlas |
| Documents & Links for Anti SV2C pAb (ATL-HPA040770) | |
| Datasheet | Anti SV2C pAb (ATL-HPA040770) Datasheet (External Link) |
| Vendor Page | Anti SV2C pAb (ATL-HPA040770) |