Protein Description: surfeit 6
Gene Name: SURF6
Alternative Gene Name: FLJ30322, RRP14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036160: 92%, ENSRNOG00000005031: 89%
Entrez Gene ID: 6838
Uniprot ID: O75683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SURF6
Alternative Gene Name: FLJ30322, RRP14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036160: 92%, ENSRNOG00000005031: 89%
Entrez Gene ID: 6838
Uniprot ID: O75683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KEKRQRVKGNLTPLTGRNYRQLLERLQARQSRLDELRGQDEGKAQELEAKMKWTNLLYKAEGVKIRDDERLL |
| Documents & Links for Anti SURF6 pAb (ATL-HPA074622) | |
| Datasheet | Anti SURF6 pAb (ATL-HPA074622) Datasheet (External Link) |
| Vendor Page | Anti SURF6 pAb (ATL-HPA074622) at Atlas |
| Documents & Links for Anti SURF6 pAb (ATL-HPA074622) | |
| Datasheet | Anti SURF6 pAb (ATL-HPA074622) Datasheet (External Link) |
| Vendor Page | Anti SURF6 pAb (ATL-HPA074622) |