Description
Product Description
Protein Description: SPT7-like STAGA complex gamma subunit
Gene Name: SUPT7L
Alternative Gene Name: KIAA0764, SPT7L, STAF65, STAF65gamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053134: 94%, ENSRNOG00000004927: 93%
Entrez Gene ID: 9913
Uniprot ID: O94864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SUPT7L
Alternative Gene Name: KIAA0764, SPT7L, STAF65, STAF65gamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053134: 94%, ENSRNOG00000004927: 93%
Entrez Gene ID: 9913
Uniprot ID: O94864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD |
Gene Sequence | PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD |
Gene ID - Mouse | ENSMUSG00000053134 |
Gene ID - Rat | ENSRNOG00000004927 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SUPT7L pAb (ATL-HPA063643) | |
Datasheet | Anti SUPT7L pAb (ATL-HPA063643) Datasheet (External Link) |
Vendor Page | Anti SUPT7L pAb (ATL-HPA063643) at Atlas Antibodies |
Documents & Links for Anti SUPT7L pAb (ATL-HPA063643) | |
Datasheet | Anti SUPT7L pAb (ATL-HPA063643) Datasheet (External Link) |
Vendor Page | Anti SUPT7L pAb (ATL-HPA063643) |