Anti SUPT7L pAb (ATL-HPA063643)

Catalog No:
ATL-HPA063643-25
$447.00

Description

Product Description

Protein Description: SPT7-like STAGA complex gamma subunit
Gene Name: SUPT7L
Alternative Gene Name: KIAA0764, SPT7L, STAF65, STAF65gamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053134: 94%, ENSRNOG00000004927: 93%
Entrez Gene ID: 9913
Uniprot ID: O94864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD
Gene Sequence PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD
Gene ID - Mouse ENSMUSG00000053134
Gene ID - Rat ENSRNOG00000004927
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SUPT7L pAb (ATL-HPA063643)
Datasheet Anti SUPT7L pAb (ATL-HPA063643) Datasheet (External Link)
Vendor Page Anti SUPT7L pAb (ATL-HPA063643) at Atlas Antibodies

Documents & Links for Anti SUPT7L pAb (ATL-HPA063643)
Datasheet Anti SUPT7L pAb (ATL-HPA063643) Datasheet (External Link)
Vendor Page Anti SUPT7L pAb (ATL-HPA063643)

Product Description

Protein Description: SPT7-like STAGA complex gamma subunit
Gene Name: SUPT7L
Alternative Gene Name: KIAA0764, SPT7L, STAF65, STAF65gamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053134: 94%, ENSRNOG00000004927: 93%
Entrez Gene ID: 9913
Uniprot ID: O94864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD
Gene Sequence PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD
Gene ID - Mouse ENSMUSG00000053134
Gene ID - Rat ENSRNOG00000004927
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SUPT7L pAb (ATL-HPA063643)
Datasheet Anti SUPT7L pAb (ATL-HPA063643) Datasheet (External Link)
Vendor Page Anti SUPT7L pAb (ATL-HPA063643) at Atlas Antibodies

Documents & Links for Anti SUPT7L pAb (ATL-HPA063643)
Datasheet Anti SUPT7L pAb (ATL-HPA063643) Datasheet (External Link)
Vendor Page Anti SUPT7L pAb (ATL-HPA063643)