Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation)

Catalog No:
ATL-HPA076890-25
$447.00
Protein Description: Sad1 and UNC84 domain containing 3
Gene Name: SUN3
Alternative Gene Name: MGC33329, SUNC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040985: 89%, ENSRNOG00000005105: 89%
Entrez Gene ID: 256979
Uniprot ID: Q8TAQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence KLREDQVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHEMPPDIILQPDVYPGKCWAFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSG
Gene ID - Mouse ENSMUSG00000040985
Gene ID - Rat ENSMUSG00000040985
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation)
Datasheet Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation) at Atlas

Documents & Links for Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation)
Datasheet Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation)