Protein Description: Sad1 and UNC84 domain containing 3
Gene Name: SUN3
Alternative Gene Name: MGC33329, SUNC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040985: 89%, ENSRNOG00000005105: 89%
Entrez Gene ID: 256979
Uniprot ID: Q8TAQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SUN3
Alternative Gene Name: MGC33329, SUNC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040985: 89%, ENSRNOG00000005105: 89%
Entrez Gene ID: 256979
Uniprot ID: Q8TAQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KLREDQVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHEMPPDIILQPDVYPGKCWAFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSG |
Documents & Links for Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation) | |
Datasheet | Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation) at Atlas |
Documents & Links for Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation) | |
Datasheet | Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SUN3 pAb (ATL-HPA076890 w/enhanced validation) |