Description
Product Description
Protein Description: sulfatase modifying factor 2
Gene Name: SUMF2
Alternative Gene Name: DKFZp566I1024
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025538: 76%, ENSRNOG00000000922: 77%
Entrez Gene ID: 25870
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SUMF2
Alternative Gene Name: DKFZp566I1024
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025538: 76%, ENSRNOG00000000922: 77%
Entrez Gene ID: 25870
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLP |
Gene Sequence | ATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLP |
Gene ID - Mouse | ENSMUSG00000025538 |
Gene ID - Rat | ENSRNOG00000000922 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SUMF2 pAb (ATL-HPA024040 w/enhanced validation) | |
Datasheet | Anti SUMF2 pAb (ATL-HPA024040 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SUMF2 pAb (ATL-HPA024040 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SUMF2 pAb (ATL-HPA024040 w/enhanced validation) | |
Datasheet | Anti SUMF2 pAb (ATL-HPA024040 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SUMF2 pAb (ATL-HPA024040 w/enhanced validation) |