Anti SUMF2 pAb (ATL-HPA024040 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA024040-25

• 

Product Description

Protein Description: sulfatase modifying factor 2
Gene Name: SUMF2
Alternative Gene Name: DKFZp566I1024
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025538: 76%, ENSRNOG00000000922: 77%
Entrez Gene ID: 25870
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLP
• Gene Sequence: ATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLP
• Gene ID - Mouse: ENSMUSG00000025538
• Gene ID - Rat: ENSRNOG00000000922
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.