Protein Description: sulfotransferase family 2B member 1
Gene Name: SULT2B1
Alternative Gene Name: HSST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003271: 93%, ENSRNOG00000021046: 89%
Entrez Gene ID: 6820
Uniprot ID: O00204
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SULT2B1
Alternative Gene Name: HSST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003271: 93%, ENSRNOG00000021046: 89%
Entrez Gene ID: 6820
Uniprot ID: O00204
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDH |
Documents & Links for Anti SULT2B1 pAb (ATL-HPA076510 w/enhanced validation) | |
Datasheet | Anti SULT2B1 pAb (ATL-HPA076510 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SULT2B1 pAb (ATL-HPA076510 w/enhanced validation) at Atlas |
Documents & Links for Anti SULT2B1 pAb (ATL-HPA076510 w/enhanced validation) | |
Datasheet | Anti SULT2B1 pAb (ATL-HPA076510 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SULT2B1 pAb (ATL-HPA076510 w/enhanced validation) |