Protein Description: sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1
Gene Name: SULT2A1
Alternative Gene Name: DHEA-ST, STD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070810: 75%, ENSRNOG00000047986: 70%
Entrez Gene ID: 6822
Uniprot ID: Q06520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SULT2A1
Alternative Gene Name: DHEA-ST, STD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070810: 75%, ENSRNOG00000047986: 70%
Entrez Gene ID: 6822
Uniprot ID: Q06520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIW |
| Documents & Links for Anti SULT2A1 pAb (ATL-HPA063633 w/enhanced validation) | |
| Datasheet | Anti SULT2A1 pAb (ATL-HPA063633 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SULT2A1 pAb (ATL-HPA063633 w/enhanced validation) at Atlas |
| Documents & Links for Anti SULT2A1 pAb (ATL-HPA063633 w/enhanced validation) | |
| Datasheet | Anti SULT2A1 pAb (ATL-HPA063633 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SULT2A1 pAb (ATL-HPA063633 w/enhanced validation) |