Protein Description: sulfatase 1
Gene Name: SULF1
Alternative Gene Name: KIAA1077, SULF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016918: 79%, ENSRNOG00000009037: 78%
Entrez Gene ID: 23213
Uniprot ID: Q8IWU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SULF1
Alternative Gene Name: KIAA1077, SULF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016918: 79%, ENSRNOG00000009037: 78%
Entrez Gene ID: 23213
Uniprot ID: Q8IWU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPTTVRVTHKCFILPNDSIHCERELYQSARAWKDHKAYIDKEIEALQD |
| Documents & Links for Anti SULF1 pAb (ATL-HPA054728) | |
| Datasheet | Anti SULF1 pAb (ATL-HPA054728) Datasheet (External Link) |
| Vendor Page | Anti SULF1 pAb (ATL-HPA054728) at Atlas |
| Documents & Links for Anti SULF1 pAb (ATL-HPA054728) | |
| Datasheet | Anti SULF1 pAb (ATL-HPA054728) Datasheet (External Link) |
| Vendor Page | Anti SULF1 pAb (ATL-HPA054728) |
| Citations for Anti SULF1 pAb (ATL-HPA054728) – 1 Found |
| Tyekucheva, Svitlana; Bowden, Michaela; Bango, Clyde; Giunchi, Francesca; Huang, Ying; Zhou, Chensheng; Bondi, Arrigo; Lis, Rosina; Van Hemelrijck, Mieke; Andrén, Ove; Andersson, Sven-Olof; Watson, R William; Pennington, Stephen; Finn, Stephen P; Martin, Neil E; Stampfer, Meir J; Parmigiani, Giovanni; Penney, Kathryn L; Fiorentino, Michelangelo; Mucci, Lorelei A; Loda, Massimo. Stromal and epithelial transcriptional map of initiation progression and metastatic potential of human prostate cancer. Nature Communications. 2017;8(1):420. PubMed |