Anti STXBP6 pAb (ATL-HPA074869)

Atlas Antibodies

Catalog No: ATL-HPA074869-25

• 

Product Description

Protein Description: syntaxin binding protein 6
Gene Name: STXBP6
Alternative Gene Name: amisyn, HSPC156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046314: 98%, ENSRNOG00000004198: 100%
Entrez Gene ID: 29091
Uniprot ID: Q8NFX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTN
• Gene Sequence: MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTN
• Gene ID - Mouse: ENSMUSG00000046314
• Gene ID - Rat: ENSRNOG00000004198
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.