Description
Product Description
Protein Description: syntaxin binding protein 6
Gene Name: STXBP6
Alternative Gene Name: amisyn, HSPC156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046314: 98%, ENSRNOG00000004198: 100%
Entrez Gene ID: 29091
Uniprot ID: Q8NFX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STXBP6
Alternative Gene Name: amisyn, HSPC156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046314: 98%, ENSRNOG00000004198: 100%
Entrez Gene ID: 29091
Uniprot ID: Q8NFX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTN |
Gene Sequence | MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTN |
Gene ID - Mouse | ENSMUSG00000046314 |
Gene ID - Rat | ENSRNOG00000004198 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti STXBP6 pAb (ATL-HPA074869) | |
Datasheet | Anti STXBP6 pAb (ATL-HPA074869) Datasheet (External Link) |
Vendor Page | Anti STXBP6 pAb (ATL-HPA074869) at Atlas Antibodies |
Documents & Links for Anti STXBP6 pAb (ATL-HPA074869) | |
Datasheet | Anti STXBP6 pAb (ATL-HPA074869) Datasheet (External Link) |
Vendor Page | Anti STXBP6 pAb (ATL-HPA074869) |