Protein Description: syntaxin binding protein 2
Gene Name: STXBP2
Alternative Gene Name: Hunc18b, UNC18B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004626: 90%, ENSRNOG00000000994: 88%
Entrez Gene ID: 6813
Uniprot ID: Q15833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STXBP2
Alternative Gene Name: Hunc18b, UNC18B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004626: 90%, ENSRNOG00000000994: 88%
Entrez Gene ID: 6813
Uniprot ID: Q15833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AKLIQHANVQAHSSLIRNLEQLGGTVTNPGGSGTSSRLEPRERMEPTYQLS |
Documents & Links for Anti STXBP2 pAb (ATL-HPA063868) | |
Datasheet | Anti STXBP2 pAb (ATL-HPA063868) Datasheet (External Link) |
Vendor Page | Anti STXBP2 pAb (ATL-HPA063868) at Atlas |
Documents & Links for Anti STXBP2 pAb (ATL-HPA063868) | |
Datasheet | Anti STXBP2 pAb (ATL-HPA063868) Datasheet (External Link) |
Vendor Page | Anti STXBP2 pAb (ATL-HPA063868) |