Anti STXBP2 pAb (ATL-HPA063868)

Catalog No:
ATL-HPA063868-25
$447.00

Description

Product Description

Protein Description: syntaxin binding protein 2
Gene Name: STXBP2
Alternative Gene Name: Hunc18b, UNC18B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004626: 90%, ENSRNOG00000000994: 88%
Entrez Gene ID: 6813
Uniprot ID: Q15833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKLIQHANVQAHSSLIRNLEQLGGTVTNPGGSGTSSRLEPRERMEPTYQLS
Gene Sequence AKLIQHANVQAHSSLIRNLEQLGGTVTNPGGSGTSSRLEPRERMEPTYQLS
Gene ID - Mouse ENSMUSG00000004626
Gene ID - Rat ENSRNOG00000000994
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STXBP2 pAb (ATL-HPA063868)
Datasheet Anti STXBP2 pAb (ATL-HPA063868) Datasheet (External Link)
Vendor Page Anti STXBP2 pAb (ATL-HPA063868) at Atlas Antibodies

Documents & Links for Anti STXBP2 pAb (ATL-HPA063868)
Datasheet Anti STXBP2 pAb (ATL-HPA063868) Datasheet (External Link)
Vendor Page Anti STXBP2 pAb (ATL-HPA063868)

Product Description

Protein Description: syntaxin binding protein 2
Gene Name: STXBP2
Alternative Gene Name: Hunc18b, UNC18B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004626: 90%, ENSRNOG00000000994: 88%
Entrez Gene ID: 6813
Uniprot ID: Q15833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKLIQHANVQAHSSLIRNLEQLGGTVTNPGGSGTSSRLEPRERMEPTYQLS
Gene Sequence AKLIQHANVQAHSSLIRNLEQLGGTVTNPGGSGTSSRLEPRERMEPTYQLS
Gene ID - Mouse ENSMUSG00000004626
Gene ID - Rat ENSRNOG00000000994
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STXBP2 pAb (ATL-HPA063868)
Datasheet Anti STXBP2 pAb (ATL-HPA063868) Datasheet (External Link)
Vendor Page Anti STXBP2 pAb (ATL-HPA063868) at Atlas Antibodies

Documents & Links for Anti STXBP2 pAb (ATL-HPA063868)
Datasheet Anti STXBP2 pAb (ATL-HPA063868) Datasheet (External Link)
Vendor Page Anti STXBP2 pAb (ATL-HPA063868)