Anti STX10 pAb (ATL-HPA056439)

Atlas Antibodies

Catalog No: ATL-HPA056439-25

• 

Product Description

Protein Description: syntaxin 10
Gene Name: STX10
Alternative Gene Name: hsyn10, SYN10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026470: 60%, ENSRNOG00000003402: 60%
Entrez Gene ID: 8677
Uniprot ID: O60499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRM
• Gene Sequence: MDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRM
• Gene ID - Mouse: ENSMUSG00000026470
• Gene ID - Rat: ENSRNOG00000003402
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.